Acetylserotonin O-methyltransferase

This MedLibrary.org supplementary page on Acetylserotonin O-methyltransferase is provided directly from the open source Wikipedia as a service to our readers. Please see the note below on authorship of this content, as well as the Wikipedia usage guidelines. To search for other content from our encyclopedia supplement, please use the form below:

acetylserotonin O-methyltransferase
Identifiers
Symbol ASMT
Entrez 438
HUGO 750
OMIM 402500
RefSeq NM_004043
UniProt P46597
Other data
EC number 2.1.1.4
Locus Chr. X p22.3

N-Acetylserotonin O-methyltransferase is an enzyme that catalyzes the final reaction in melatonin biosynthesis, converting Normelatonin to melatonin. This reaction is embedded in the more general tryptophan metabolism pathway. The enzyme also catalyzes a second reaction in tryptophan metabolism: the conversion of 5-hydroxy-indoleacetate to 5-methoxy-indoleacetate. [1]

Contents

Structure and Gene Location

N- Acetylserotonin O-methyltransferase is an enzyme that is coded for by genes located on the PAR region of the X and Y chromosome, and is most abundantly found in the pineal gland and retina of humans. [2]

Although the exact structure of N- Acetylserotonin O-methyltransferase has yet to be determined by X-Ray diffraction, the crystal structure of the Maf domain of human N- Acetylserotonin O-methyltransferase-like protein has been found. [3]

Class of Enzyme and Function

N- Acetylserotonin O-methyltransferase can be classified under three types of enzyme functional groups: transferases, one-carbon group transferers, and methyltransferases. [4] It catalyzes two reactions in the tryptophan metabolism pathway, and both can be traced back to serotonin. Serotonin has many fates in this pathway, and N- Acetylserotonin O-methyltransferase catalyzes reactions in two of these fates. The enzyme has been studied most for its catalysis of the final step of the pathway from serotonin to melatonin, but it also catalyzes one of the reactions in the many step process of serotonin → 5-Methoxy-indolacetate. Figure 1 is a clear picture of where N- Acetylserotonin O-methyltransferase is used during tryptophan metabolism (see two locations of enzyme number 2.1.1.4) [5]

Figure 1.


Synonyms

Synonyms of N- Acetylserotonin O-methyltransferase are Hydroxyindole O-methyltransferase (HIOMT), Acetylserotonin O-methyltransferase (ASMT), Acetylserotonin N-methyltransferase, Acetylserotonin methyltransferase (Y chromosome).[6] The most commonly used synonym is Hydroxyindole O-methyltransferase (HIOMT).

Organisms

N- Acetylserotonin O-methyltransferase is found in both prokaryotes and eukaryotes. It is found in the bacteria Rhodopirellula baltica and Chromobacterium violaceum. It is also found in the following eukaryotes: Gallus gallus (chicken), Bos Taurus (cow), Homo sapiens (human), Macaca mulatta (rhesus monkey), and Rattus norvegicus (rat). [7]

Amino Acid Sequences

[8] Bos taurus (350 Amino Acids)

MCSQEGEGYSLLKEYANAFMVSQVLFAACELGVFELLAEALEPLDSAAVSSHLGSSPGD RAATEHLCVPEAAASRREGRKSCVCKHGARQHLPGERQPQVPAGHAAVRGQDRLRLLAP PGEAVREGRNQYLKAFGIPSEELFSAIYRSEDERLQFMQGLQDVWRLEGATVLAAFDLS PFPLICDLGGGSGALAKACVSLYPGCRAIVFDIPGVVQIAKRHFSASEDERISFHEGDF FKDALPEADLYILARVLHDWTDAKCSHLLQRVYRACRTGGGILVIESLLDTDGRGPLTT LLYSLNMLVQTEGRERTPGRSTARSVGPAASETCGDGGRGEPTMLSWPGNQACSV

Homo sapiens (373 Amino Acids)

MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHG TELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWG HLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDL SVFPLMCDLGGTRIKLETIILSKLSQGQKTKHRVFSLIGGAGALAKECMSLYPGCKITV FDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLE RIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGF RDFQFKKTGAIYDAILARK

Alternative splicing

The human HOIMT gene is approximately 35 kb in length and contains 9-10 exons. The gene can be alternatively spliced to form at least three possible isoforms, although each of these isoforms has the same role in the biosynthesis of melatonin. It has also been found that the gene contains multiple promoter regions, an indication that multiple mechanisms of regulation exist. [9]

Expression in immune cells

Recent studies found mRNA transcripts of the HOIMT gene in B lymphocytes, T helper lymphocytes, cytoxic T lymphocytes, and natural killer lymphocytes in humans. This finding, in conjunction with research on alternative splicing of the HOIMT hnRNA, suggests that Hydroxyindole O-methyltransferase (synonym for N- Acetylserotonin O-methyltransferase) plays a role in the human immune system, in addition to its endoctrine and nervous system functions. In other words, the gene may be expressed in various isoforms in different cells of the body. [10]

Reactions catalyzed

In the tryptophan metabolism pathway, N- Acetylserotonin O-methyltransferase catalyzes two separate reactions. The first reaction shown (Figure 2) is the reaction of N-acetyl-serotonin to N-acetyl-5-methoxy-tryptamine. S-adenosyl-L-methionine is used as a substrate and is converted to S-adenosyl-L-homocysteine. [11]

Figure 2: Reaction catalyzed by N- Acetylserotonin O-methyltransferase


Figure 3 is the same reaction as above, but the figure provides a clearer picture of how the reactant proceeds to product using N-Acetylserotonin O-methyltransferase in addition to the substrate. [12]

Figure 3: Role of N- Acetylserotonin O-methyltransferase


The second reaction (Figure 4) catalyzed by N-Acetylserotonin O-methyltransferase in the tryptophan metabolism pathway is: S-Adenosyl-L-methionine + 5-Hydroxyindoleacetate ↔ S-Adenosyl-L-homocysteine + 5-Methoxyindoleacetate. [13]

Figure 4: Second reaction catalyzed by N- Acetylserotonin O-methyltransferase


Figure 5 is a more general scheme of the reaction pathway from serotonin to melatonin. The number 2.1.1.4 refers to the Enzyme Commission Number (EC Number) for N- Acetylserotonin O-methyltransferase. These two steps are embedded in the highly involved tryptophan metabolism pathway. [14]


Figure 5: Pathway serotonin → melatonin


Clinical implications

Tumors

There is evidence of high HIOMT gene expression in pineal parenchymal tumors (PPTs). This finding has led to the study of varying gene expression as a diagnostic marker for such tumors. Abnormally high levels of HIOMT in these glands could serve as an indication of the existence of PPTs in the brain. [15]

Psychiatric Disorders

Melatonin levels are used as a trait marker for mood disorders, meaning that abnormal levels of melatonin can be used in conjunction with other diagnostic criteria to determine whether a mood disorder (eg Seasonal affective disorder, bipolar disorder, or major depressive disorder) exists. Melatonin levels can also be used as a state marker, contributing to conclusions on the severity of a patient’s illness at a given point in time. Because studies have shown a direct correlation between the amount of hydroxyindole-O-methyltransferase in the pineal gland and the melatonin level, additional knowledge of HOIMT could provide valuable insight on the nature and onset of these impairing disorders. [16]

Linkage analysis

High frequency polymorphism exists on the PAR region of the sex chromosomes, where the HIOMT gene is located. Linkage analysis of a diseased locus with high frequency polymorphism of this region could lead to vital information about the role of the this gene in genetic disorders. [17]

Additional research

HIOMT as the limiting reagent in the melatonin biosynthetic pathway

There has been some controversy over the regulatory power of hydroxyindole-O-methyltransferase in the production of melatonin. In 2001, it was argued that another enzyme in the pathway, N-acetyl transferase (NAT) was the limiting reagent in the production of melatonin.[18] Recent findings, however, have suggested that HIOMT, not NAT, is the limiting reagent, and a direct correlation between HIOMT expression and melatonin levels has been shown to exist. [19]

See also

References

  1. ^ Kanehisa, M., Goto, S., Hattori, M., Aoki-Kinoshita, K.F., Itoh, M., Kawashima, S., Katayama, T., Araki, M., and Hirakawa, M.; From genomics to chemical genomics: new developments in KEGG. Nucleic Acids Res. 34, D354-357 (2006). [pubmed] [pdf] [See also comments in Thomson's website]
  2. ^ Online Mendelian Inheritance in Man, OMIM (TM). Johns Hopkins University, Baltimore, MD. MIM Number: {300015}: {11/19/1998}: . World Wide Web URL: http://www.ncbi.nlm.nih.gov/omim/
  3. ^ PDB ID: 2P5X Min, J., Wu, H., Dombrovski, L., Loppanu, P., Weigelt, J., Sundstrom, M., Arrowsmith, C.H., Edwards, A.M., Bochkarve, A., Plotnikov, A.M., Crystal Structure of Maf Domain of Human N- Acetylseratonin O-methyltransferase Structural Genomics Consotrium (SGC) (2007) URL: http://www.rcsb.org/pdb/explore.do?structureId=2P5X
  4. ^ Kanehisa, M., KEGG. (2006)
  5. ^ Kanehisa, M., KEGG. (2006)
  6. ^ Kanehisa, M., KEGG. (2006)
  7. ^ Kanehisa, M., KEGG. (2006)
  8. ^ Kanehisa, M., KEGG. (2006)
  9. ^ Rodriguez, I.R. et al. Structural analysis of the human hydroxyindole-O-methyltransferase gene. Journal of biological chemistry. 1994 Dec 16; 269(50):31969-77. URL: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=search&Dopt=b&term=7989373
  10. ^ Pozo, D., Garcia-Maurino, S., Guerrero, J.M., Calvo, J.R. Journal of Pineal Research. 2004 Aug;37(1):48-54. URL: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=search&Dopt=b&term=15230868
  11. ^ Ron Caspi, Hartmut Foerster, Carol A. Fulcher, Rebecca Hopkinson, John Ingraham, Pallavi Kaipa, Markus Krummenacker, Suzanne Paley, John Pick, Seung Y. Rhee, Christophe Tissier, Peifen Zhang and Peter D. Karp. “MetaCyc: a multiorganism database of metabolic pathways and enzymes.” Nucleic Acids Research Oct. 2005: Vol 34- SRI International, 333 Ravenswood, Menlo Park, CA 94025, USA, Department of Plant biology, Carnegie Institution, 260 Panama Street, Stanford, CA 94305, USA and 2Section of Microbiology, University of California, Davis, One Shields Avenue, Davis, CA 95616, USA. Accessed 25 Apr. 2007 URL: http://www.ai.sri.com/pkarp/pubs/06metacyc.pdf
  12. ^ Kanehisa, M., KEGG. (2006)
  13. ^ Kanehisa, M., KEGG. (2006)
  14. ^ PUMA2--grid-based high-throughput analysis of genomes and metabolic pathways. Maltsev N, Glass E, Sulakhe D, Rodriguez A, Syed MH, Bompada T, Zhang Y, D'Souza M. Nucleic Acids Res. 2006 Jan 1;34 (Database issue):D369-72. URL: http://compbio.mcs.anl.gov/puma2/cgi-bin/pathway.cgi?tax_id=&user=&key=&header=puma2&pw=SRTMEL.ANA
  15. ^ Fevre Montagne, M. et al. Microarray analysis reveals differential gene expression patterns in tumors of the pineal region. Journal of neuropathology and experimental neurology. 2006 Jul;65(7):675-84. URL: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=search&Dopt=b&term=16825954
  16. ^ Venkataramanujan, S. et al. Melatonin in Mood Disorders. World Journal of Biological Psychiatry. 2006 Aug:7(3):138-151. URL: http://www.informaworld.com/smpp/content~content=a749302090~db=all
  17. ^ Huafang, Y. et al. Localization of the hydroxyindole-O-methyltransferase gene to the pseudoautosomal region: implications for mapping of psychiatric disorders. Human Molecular Genetics. 1993:2(2):127-131. URL: http://hmg.oxfordjournals.org/cgi/content/abstract/2/2/127http://hmg.oxfordjournals.org/cgi/content/abstract/2/2/127
  18. ^ Djeridane, Y., and Touitou, Y. Chronic diazepam administration differentially affects melatonin synthesis in rat pineal and Harderian glands. Psychopharmacology. 2001 April:154(4):1432-2072. URL: http://www.springerlink.com/content/5gd87g0bpyjth15h/
  19. ^ Reiter, R.J., Tan, D., Terron, M.P., Flores, L.J. Melatonin and its metabolites: new findings regarding their production and their radical scavenging actions. Acta Biochemica Polonica. 2007 March:54(1):1-9.

External links

Wikipedia content modification information:

  • This page was last modified on 28 September 2008, at 10:23.

Wikipedia Authorship and Review

Wikipedia content provided here is not reviewed directly by MedLibrary.org. Wikipedia content is authored by an open community of volunteers and is not produced by or in any way affiliated with MedLibrary.org.

Wikipedia Usage Guidelines

This article is licensed under the GNU Free Documentation License. It uses material from the Wikipedia article on "Acetylserotonin O-methyltransferase".

The URL for this specific entry is:

All Wikipedia text is available under the terms of the GNU Free Documentation License. (See Copyrights for details). Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc.