Corticotropin-releasing hormone

This MedLibrary.org supplementary page on Corticotropin-releasing hormone is provided directly from the open source Wikipedia as a service to our readers. Please see the note below on authorship of this content, as well as the Wikipedia usage guidelines. To search for other content from our encyclopedia supplement, please use the form below:

Corticotropin releasing hormone
PDB rendering based on 1go9.
Available structures: 1go9, 1goe
Identifiers
Symbols CRH; CRF
External IDs OMIM: 122560 MGI88496 HomoloGene599
RNA expression pattern

More reference expression data

Orthologs
Human Mouse
Entrez 1392 12918
Ensembl ENSG00000147571 ENSMUSG00000049796
Uniprot P06850 Q14AA2
Refseq NM_000756 (mRNA)
NP_000747 (protein)
NM_205769 (mRNA)
NP_991338 (protein)
Location Chr 8: 67.25 - 67.25 Mb Chr 3: 19.89 - 19.89 Mb
Pubmed search [1] [2]

Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and neurotransmitter involved in the stress response.

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer's disease, and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially-fatal metabolic consequences including hypoglycemia and hepatitis. In addition to being produced in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta, CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.[1]

Contents

Hormonal actions

CRH is produced by neuroendocrine cells in the paraventricular nucleus of the hypothalamus and is released from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system. The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete corticotropin (ACTH) and other biologically-active substances (for example β-endorphin).

α-helical CRH-(9–41) acts as a CRH antagonist.[2]

Psychopharmacy

The CRH-1 receptor antagonist pexacerfont is currently under investigation for the treatment of Generalized anxiety disorder in women.[3] Another CRH-1 antagonist antalarmin has been researched in animal studies for the treatment of anxiety, depression and other conditions, but no human trials with this compound have been carried out.

Also, abnormal levels of CRH have been found in the cerebrospinal fluid of suicide victims.[4]

Recent research has linked the activation of the CRH1 receptor with the euphoric feelings that accompany alcohol consumption. A CRH1 receptor antagonist developed by Pfizer, CP-154,526 is under investigation for the potential treatment of alcoholism.[5][6]

Role in parturition

CRH is also synthesized by the placenta and seems to determine the duration of pregnancy.[7]

Levels rise towards birth and current theory suggests three roles of CRH in parturition:[8]

  • Increases level so dehydroepiandrosterone (DHEA) directly by action on the fetal adrenal gland, and indirectly via the mother's pituitary gland. DHEA has a role in preparing for and stimulating cervical contractions.
  • Increases prostaglandin availability in uteroplacental tissues. Prostaglandins activate cervical contractions.
  • Prior to parturition it may have a role inhibiting contractions, through increasing cAMP levels in the myometrium.

In culture, trophoblast CRH is inhibited by progesterone, which remains high throughout pregnancy. Its release is stimultated by glucocorticoids and catecholamines, which increase prior to parturition lifting this progesterone block.[9]

Structure

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al in 1981.[10] Its full sequence is:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

See also


References

  1. ^ "Entrez Gene: CRH corticotropin releasing hormone".
  2. ^ Santos J, Saunders PR, Hanssen NP, Yang PC, Yates D, Groot JA, Perdue MH (August 1999). "Corticotropin-releasing hormone mimics stress-induced colonic epithelial pathophysiology in the rat". Am. J. Physiol. 277 (2 Pt 1): G391–9. PMID 10444454. 
  3. ^ "Study of Pexacerfont (BMS-562086) in the Treatment of Outpatients With Generalized Anxiety Disorder". ClinicalTrials.gov (2008-08-01). Retrieved on 2008-08-03.
  4. ^ Arató M, Bánki CM, Bissette G, Nemeroff CB (1989). "Elevated CSF CRF in suicide victims". Biol. Psychiatry 25 (3): 355–9. doi:10.1016/0006-3223(89)90183-2. PMID 2536563. 
  5. ^ "Drug Has Potential To Prevent Alcoholics From Relapsing". Science News. ScienceDaily (2008-08-02). Retrieved on 2008-08-09.
  6. ^ Pastor R, McKinnon CS, Scibelli AC, Burkhart-Kasch S, Reed C, Ryabinin AE, Coste SC, Stenzel-Poore MP, Phillips TJ (July 2008). "Corticotropin-releasing factor-1 receptor involvement in behavioral neuroadaptation to ethanol: a urocortin1-independent mechanism". Proc. Natl. Acad. Sci. U.S.A. 105 (26): 9070–5. doi:10.1073/pnas.0710181105. PMID 18591672. 
  7. ^ Kimball JW (2006-06-15). "Hormones of the Hypothalamus". Kimball's Biology Pages. Retrieved on 2008-08-03.
  8. ^ Lye S, Challis JRG (2001). "Chapter 12: Parturition", in Bocking AD, Harding R: Fetal growth and development. Cambridge, UK: Cambridge University Press, pages 241-266. ISBN 0-521-64543-3. 
  9. ^ Jones SA, Brooks AN, Challis JR (April 1989). "Steroids modulate corticotropin-releasing hormone production in human fetal membranes and placenta". J. Clin. Endocrinol. Metab. 68 (4): 825–30. PMID 2537843. 
  10. ^ Vale W, Spiess J, Rivier C, Rivier J (September 1981). "Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin". Science (journal) 213 (4514): 1394–7. PMID 6267699. 

Further reading

  • Florio P, Severi FM, Ciarmela P, et al. (2003). "Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family". Endocrine 19 (1): 91–102. doi:10.1385/ENDO:19:1:91. PMID 12583606. 
  • Florio P, Rossi M, Sigurdardottir M, et al. (2003). "Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A". Steroids 68 (10-13): 801–7. doi:10.1016/S0039-128X(03)00137-5. PMID 14667971. 
  • Vamvakopoulos NC, Karl M, Mayol V, et al. (1990). "Structural analysis of the regulatory region of the human corticotropin releasing hormone gene". FEBS Lett. 267 (1): 1–5. doi:10.1016/0014-5793(90)80272-K. PMID 2365075. 
  • Robinson BG, D'Angio LA, Pasieka KB, Majzoub JA (1989). "Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing". Mol. Cell. Endocrinol. 61 (2): 175–80. doi:10.1016/0303-7207(89)90128-7. PMID 2783917. 
  • Arbiser JL, Morton CC, Bruns GA, Majzoub JA (1988). "Human corticotropin releasing hormone gene is located on the long arm of chromosome 8". Cytogenet. Cell Genet. 47 (3): 113–6. doi:10.1159/000132525. PMID 3259914. 
  • Sasaki A, Tempst P, Liotta AS, et al. (1988). "Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta". J. Clin. Endocrinol. Metab. 67 (4): 768–73. PMID 3262120. 
  • Shibahara S, Morimoto Y, Furutani Y, et al. (1984). "Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene". EMBO J. 2 (5): 775–9. PMID 6605851. 
  • Behan DP, Heinrichs SC, Troncoso JC, et al. (1995). "Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease". Nature 378 (6554): 284–7. doi:10.1038/378284a0. PMID 7477348. 
  • Kawahito Y, Sano H, Mukai S, et al. (1996). "Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis". Gut 37 (4): 544–51. doi:10.1136/gut.37.4.544. PMID 7489943. 
  • McLean M, Bisits A, Davies J, et al. (1995). "A placental clock controlling the length of human pregnancy". Nat. Med. 1 (5): 460–3. doi:10.1038/nm0595-460. PMID 7585095. 
  • Slominski A, Ermak G, Hwang J, et al. (1995). "Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin". FEBS Lett. 374 (1): 113–6. doi:10.1016/0014-5793(95)01090-2. PMID 7589495. 
  • Sutton SW, Behan DP, Lahrichi SL, et al. (1995). "Ligand requirements of the human corticotropin-releasing factor-binding protein". Endocrinology 136 (3): 1097–102. doi:10.1210/en.136.3.1097. PMID 7867564. 
  • Vamvakopoulos NC, Chrousos GP (1994). "Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene". DNA Seq. 4 (3): 197–206. doi:10.3109/10425179309015632. PMID 8161822. 
  • Perrin MH, Donaldson CJ, Chen R, et al. (1994). "Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor". Endocrinology 133 (6): 3058–61. doi:10.1210/en.133.6.3058. PMID 8243338. 
  • Romier C, Bernassau JM, Cambillau C, Darbon H (1993). "Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics". Protein Eng. 6 (2): 149–56. doi:10.1093/protein/6.2.149. PMID 8386360. 
  • Liaw CW, Grigoriadis DE, Lovenberg TW, et al. (1997). "Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach". Mol. Endocrinol. 11 (7): 980–5. doi:10.1210/me.11.7.980. PMID 9178757. 
  • Timpl P, Spanagel R, Sillaber I, et al. (1998). "Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1". Nat. Genet. 19 (2): 162–6. doi:10.1038/520. PMID 9620773. 
  • Perone MJ, Murray CA, Brown OA, et al. (1998). "Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells". Mol. Cell. Endocrinol. 142 (1-2): 191–202. doi:10.1016/S0303-7207(98)00104-X. PMID 9783915. 
  • Willenberg HS, Bornstein SR, Hiroi N, et al. (2000). "Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function". Mol. Psychiatry 5 (2): 137–41. doi:10.1038/sj.mp.4000720. PMID 10822340. 
  • Saeed B, Fawcett M, Self C (2001). "Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes". Eur. J. Clin. Invest. 31 (2): 125–30. doi:10.1046/j.1365-2362.2001.00770.x. PMID 11168450. 

Wikipedia content modification information:

  • This page was last modified on 29 August 2008, at 16:51.

Wikipedia Authorship and Review

Wikipedia content provided here is not reviewed directly by MedLibrary.org. Wikipedia content is authored by an open community of volunteers and is not produced by or in any way affiliated with MedLibrary.org.

Wikipedia Usage Guidelines

This article is licensed under the GNU Free Documentation License. It uses material from the Wikipedia article on "Corticotropin-releasing hormone".

The URL for this specific entry is:

All Wikipedia text is available under the terms of the GNU Free Documentation License. (See Copyrights for details). Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc.